Rabbit polyclonal anti-PACRG antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 204-215 of Human PACRG protein. |
Rabbit Polyclonal Anti-PACRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PACRG antibody: synthetic peptide directed towards the middle region of human PACRG. Synthetic peptide located within the following region: GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ |
PACRG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China