Antibodies

View as table Download

PA1 (PAGR1) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal GAS Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen GAS antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human GAS.

Rabbit Polyclonal Anti-PAGR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C16orf53 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf53. Synthetic peptide located within the following region: GPSASAGKAEDEGEGGREETEREGSGGEEAQGEVPSAGGEEPAEEDSEDW