PA1 (PAGR1) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
PA1 (PAGR1) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal GAS Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | GAS antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human GAS. |
Rabbit Polyclonal Anti-PAGR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-C16orf53 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf53. Synthetic peptide located within the following region: GPSASAGKAEDEGEGGREETEREGSGGEEAQGEVPSAGGEEPAEEDSEDW |