Rabbit Polyclonal Anti-PAIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAIP1 antibody: synthetic peptide directed towards the C terminal of human PAIP1. Synthetic peptide located within the following region: EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY |
Rabbit Polyclonal Anti-PAIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAIP1 antibody: synthetic peptide directed towards the N terminal of human PAIP1. Synthetic peptide located within the following region: MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS |
PAIP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PAIP1 |
PAIP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PAIP1 (NP_877590.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
