Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-Parp8 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Parp8 antibody: synthetic peptide directed towards the N terminal of human Parp8. Synthetic peptide located within the following region: ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD |
Rabbit Polyclonal anti-Parp8 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Parp8 antibody: synthetic peptide directed towards the C terminal of human Parp8. Synthetic peptide located within the following region: LIGILTPSSSSSQPPVRKHFHLAFLHVAKGQEICLHFLIRPGRGKKQDTC |
PARP8 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PARP8 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PARP8 (NP_001171527.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PARP8