Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PAX6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR |
PAX6 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PAX6 |
Goat Polyclonal Antibody against PAX6
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REEKLRNQRRQASN, from the internal region of the protein sequence according to NP_000271.1; NP_001595.2. |
Rabbit polyclonal anti-PAX6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 303 of rat PAX6 |
Rabbit Polyclonal Anti-PAX6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: GRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCV |
PAX6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAX6 |
PAX6 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PAX6 (NP_000271.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PAX6