Antibodies

Jump to Filters
View as table Download
Baf180 (PBRM1) Rabbit Polyclonal Antibody
TA345238

USD 475.00

5 Days

Rabbit Polyclonal Anti-PBRM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PBRM1 antibody: synthetic peptide directed towards the middle region of human PBRM1. Synthetic peptide located within the following region: SAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALW
Baf180 (PBRM1) Rabbit Polyclonal Antibody
TA379661

USD 220.00

3 Weeks

PBRM1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PBRM1 (NP_060783.3).
Modifications Unmodified