Antibodies

Jump to Filters
View as table Download
PCDHA4 (C-term) Rabbit Polyclonal Antibody
AP53198PU-N

USD 450.00

2 Weeks

PCDHA4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 760-790 amino acids from the C-terminal region of human PCDHA4
PCDHA4 Rabbit Polyclonal Antibody
TA331058

USD 375.00

5 Days

Rabbit polyclonal Anti-PCDHA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDHA4 antibody: synthetic peptide directed towards the N terminal of human PCDHA4. Synthetic peptide located within the following region: VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD
PCDHA4 Rabbit Polyclonal Antibody
TA341926

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCDHA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDHA4 antibody: synthetic peptide directed towards the C terminal of human PCDHA4. Synthetic peptide located within the following region: SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL