Rabbit Polyclonal Anti-PCGF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCGF1 antibody: synthetic peptide directed towards the middle region of human PCGF1. Synthetic peptide located within the following region: PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV |
PCGF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCGF1 |
PCGF1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-259 of human PCGF1 (NP_116062.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China