Mouse Monoclonal Anti-Piccolo Antibody
Applications | WB |
Reactivities | Human, Rat. Other species not yet tested |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-Piccolo Antibody
Applications | WB |
Reactivities | Human, Rat. Other species not yet tested |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Piccolo Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat. Not yet tested on other species |
Conjugation | Unconjugated |
Immunogen | Full length protein |
Rabbit Polyclonal Anti-PCLO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCLO antibody is: synthetic peptide directed towards the C-terminal region of Human PCLO. Synthetic peptide located within the following region: SHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVT |