Antibodies

View as table Download

Rabbit anti-PDGFB Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-BB.

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) Recombinant Human PDGF-B.

PDGF beta (PDGFB) (222-233) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Human, Sheep
Immunogen Synthetic peptide from C-Terminus of human PDGFB (NP_002599.1; NP_148937.1)

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) Recombinant Human PDGF-B.

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-BB.

Anti-Human PDGF-BB Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PDGF-BB

Rabbit polyclonal anti-PDGFB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PDGFB.

Rabbit Polyclonal PDGF-B Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal PDGF-B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PDGF-B.

Biotinylated Anti-Human PDGF-BB Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PDGF-BB

Rabbit Polyclonal PDGFB Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit polyclonal anti-PDGF-BB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human PDGF-BB

Rabbit polyclonal anti-PDGF-BB antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen E. coli expressed murine PDGF-BB

Rabbit Polyclonal PDGFB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human PDGFB.

Anti-PDGFB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-115 amino acids of Human platelet-derived growth factor beta polypeptide

PDGF B Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PDGFB. AA range:16-65