Antibodies

Jump to Filters
View as table Download
SCDGFB (PDGFD) Rabbit Polyclonal Antibody
TA344192

USD 475.00

5 Days

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
SCDGFB (PDGFD) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
CF503700

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pdgfd Rabbit Polyclonal Antibody
TA363175

USD 360.00

5 Days

PDGFD Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDGFD
PDGFD Rabbit Polyclonal Antibody
TA364914

USD 380.00

4 Weeks

PDGFD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PDGFD
PDGFD Rabbit Polyclonal Antibody
TA369259

USD 380.00

4 Weeks

PDGFD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PDGFD
SCDGFB (PDGFD) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA503700

USD 379.00

In Stock

PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SCDGFB (PDGFD) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA503700S

USD 159.00

2 Days

PDGFD mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated