Germany
Japan
United Kingdom
China
Rabbit Polyclonal PDI Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified full-length liver protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PDIA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDIA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDIA2. Synthetic peptide located within the following region: EFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLED |
Anti-PDIA2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 341-353 amino acids of Human protein disulfide isomerase family A, member 2 |
PDIA2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDIA2 |
PDIA2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 326-525 of human PDIA2 (NP_006840.2). |
| Modifications | Unmodified |
PDIA2 Rabbit polyclonal Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PDI |
Active filters
Target Symbol
- PDIA2