Rabbit Polyclonal Antibody against PDK2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PDK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-407 amino acids from the C-terminal region of human PDK2. |
Rabbit polyclonal PDK2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDK2. |
Rabbit Polyclonal anti-PDK2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDK2 antibody: synthetic peptide directed towards the middle region of human PDK2. Synthetic peptide located within the following region: ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI |
Anti-PDK2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 10-24 amino acids of human pyruvate dehydrogenase kinase, isozyme 2 |
Anti-PDK2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 10-24 amino acids of human pyruvate dehydrogenase kinase, isozyme 2 |
PDK2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-407 of human PDK2 (NP_002602.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
