Antibodies

Jump to Filters
View as table Download
ALP (PDLIM3) Rabbit Polyclonal Antibody
TA334543

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDLIM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDLIM3 antibody: synthetic peptide directed towards the N terminal of human PDLIM3. Synthetic peptide located within the following region: PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA
ALP (PDLIM3) Rabbit Polyclonal Antibody
TA379771

USD 220.00

3 Weeks

PDLIM3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-230 of human PDLIM3 (NP_001107579.1).
Modifications Unmodified