Rabbit Polyclonal Anti-PELI3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PELI3 antibody: synthetic peptide directed towards the N terminal of human PELI3. Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG |
Rabbit Polyclonal Anti-PELI3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PELI3 antibody: synthetic peptide directed towards the N terminal of human PELI3. Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG |
PELI3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PELI3 (NP_659502.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China