Antibodies

Jump to Filters
View as table Download
PHF20 (N-term) Rabbit Polyclonal Antibody
AP53282PU-N

USD 450.00

2 Weeks

PHF20 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 130-159 amino acids from the N-terminal region of human PHF20
PHF20 Rabbit Polyclonal Antibody
TA339488

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHF20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHF20 antibody: synthetic peptide directed towards the C terminal of human PHF20. Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS
PHF20 Rabbit Polyclonal Antibody
TA379870

USD 220.00

3 Weeks

PHF20 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-380 of human PHF20 (NP_057520.2).
Modifications Unmodified