Rabbit Polyclonal Anti-PHF6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF6 antibody: synthetic peptide directed towards the middle region of human PHF6. Synthetic peptide located within the following region: LEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSP |
Rabbit Polyclonal Anti-PHF6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF6 antibody: synthetic peptide directed towards the C terminal of human PHF6. Synthetic peptide located within the following region: DFDIKTVLQEIKRGKRMVCSFYICYATLHLICCFKFRVHPKFIQSSENLK |
Rabbit Polyclonal Anti-PHF6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF6 antibody: synthetic peptide directed towards the N terminal of human PHF6. Synthetic peptide located within the following region: VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFH |
PHF6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PHF6. |
PHF6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human PHF6 (NP_115711.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
