Rabbit Polyclonal Anti-PHYH Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHYH antibody: synthetic peptide directed towards the middle region of human PHYH. Synthetic peptide located within the following region: EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI |
Rabbit Polyclonal Anti-PHYH Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHYH antibody: synthetic peptide directed towards the N terminal of human PHYH. Synthetic peptide located within the following region: TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR |
PHYH Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PHYH |
PHYH Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of human PHYH (NP_006205.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
