Antibodies

Jump to Filters
View as table Download
PI4KB (Center) Rabbit Polyclonal Antibody
AP17647PU-N

USD 450.00

2 Weeks

PI4KB (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Zebrafish
Immunogen KLH conjugated synthetic peptide between 519-548 amino acids from the Center region of Human PIK4CB.
PI4KB Rabbit Polyclonal Antibody
TA337683

USD 375.00

5 Days

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN
PI4KB Rabbit Polyclonal Antibody
TA337684

USD 375.00

5 Days

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the middle region of human PI4KB. Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM
PI4KB Rabbit Polyclonal Antibody
TA379907

USD 220.00

3 Weeks

PI4KB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 560-801 of human PI4KB (NP_001185702).
Modifications Unmodified