PIEZO2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIEZO2 |
PIEZO2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIEZO2 |
Rabbit Polyclonal PIEZO2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PIEZO2 protein (between residues 1600-1650) [UniProt Q9H5I5] |
Rabbit Polyclonal Anti-PIEZO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIEZO2 antibody is: synthetic peptide directed towards the N-terminal region of Human PIEZO2. Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK |
Rabbit Polyclonal Anti-PIEZO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIEZO2antibody: synthetic peptide directed towards the middle region of human FAM38B. Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS |
FAM38B (PIEZO2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 366-396 amino acids of human FAM38B |
Rabbit Polyclonal Anti-PIEZO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PIEZO2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human PIEZO2. |
PIEZO2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIEZO2 |