Antibodies

View as table Download

Rabbit Polyclonal Anti-PIGO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGO antibody: synthetic peptide directed towards the N terminal of human PIGO. Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

PIGO Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PIGO.