Antibodies

View as table Download

Rabbit Polyclonal Anti-PIGQ Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL

Rabbit Polyclonal Anti-PIGQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS

PIGQ rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PIGQ

PIGQ rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PIGQ

PIGQ Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PIGQ (NP_683721.1).