Antibodies

Jump to Filters
View as table Download
PILRA Rabbit Polyclonal Antibody
TA341919

USD 375.00

5 Days

Rabbit Polyclonal Anti-PILRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PILRA antibody: synthetic peptide directed towards the N terminal of human PILRA. Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN
PILRA Rabbit Polyclonal Antibody
TA379947

USD 220.00

3 Weeks

PILRA Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PILRA.