Rabbit Polyclonal Anti-PITPNM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITPNM1 antibody: synthetic peptide directed towards the N terminal of human PITPNM1. Synthetic peptide located within the following region: PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAK |
Rabbit Polyclonal Anti-PITPNM1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PITPNM1 |
PITPNM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human PITPNM1 (NP_004901.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China