Germany
Japan
United Kingdom
China
MIWI Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse MIWI |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PIWIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the N terminal of human PIWIL1. Synthetic peptide located within the following region: FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR |
Rabbit Polyclonal Anti-PIWIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the middle region of human PIWIL1. Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY |
Goat Anti-PIWI / HIWI Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNRKDKYDAIKKY, from the internal region of the protein sequence according to NP_004755.2; NP_001177900.1. |
Anti-PIWIL1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 555-847 amino acids of human piwi-like RNA-mediated gene silencing 1 |
MIWI Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse PIWIL1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- PIWIL1