Rabbit polyclonal Anti-C9orf46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL |
Rabbit polyclonal Anti-C9orf46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK |
Plasminogen Receptor Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human PLGRKT. AA range:1-50 |
Germany
Japan
United Kingdom
China