Antibodies

Jump to Filters
View as table Download
Plexin A2 (PLXNA2) Rabbit Polyclonal Antibody
TA339547

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLXNA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLXNA2 antibody: synthetic peptide directed towards the N terminal of human PLXNA2. Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Plexin A2 (PLXNA2) Rabbit Polyclonal Antibody
TA351538

USD 345.00

In Stock

Rabbit Polyclonal Anti-PLXNA2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLXNA2
PLXNA2 Rabbit Polyclonal Antibody
TA367194

USD 380.00

4 Weeks

PLXNA2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLXNA2
Plexin A2 (PLXNA2) Rabbit Polyclonal Antibody
TA380065

USD 220.00

3 Weeks

PLXNA2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-560 of human PLXNA2 (NP_079455.3).
Modifications Unmodified