Antibodies

View as table Download

Rabbit Polyclonal Anti-PNMA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNMA3 antibody: synthetic peptide directed towards the N terminal of human PNMA3. Synthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Rabbit Polyclonal Anti-PNMA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNMA3 antibody: synthetic peptide directed towards the middle region of human PNMA3. Synthetic peptide located within the following region: RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR

Carrier-free (BSA/glycerol-free) PNMA3 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PNMA3 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PNMA3 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PNMA3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

PNMA3 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PNMA3 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human
Conjugation Unconjugated

PNMA3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

PNMA3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

PNMA3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human
Conjugation Unconjugated