Rabbit Polyclonal Anti-PNOC Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNOC antibody: synthetic peptide directed towards the middle region of human PNOC. Synthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY |
Rabbit polyclonal anti Nociceptin; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg- Lys-Leu-Ala-Asn-Gln-OH coupled to carrier protein. |
Anti-PONC Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 134-146 amino acids of human prepronociceptin |
Germany
Japan
United Kingdom
China
