Antibodies

Jump to Filters
View as table Download
PNRC1 Rabbit Polyclonal Antibody
TA340140

USD 375.00

5 Days

Rabbit Polyclonal Anti-PNRC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNRC1 antibody: synthetic peptide directed towards the middle region of human PNRC1. Synthetic peptide located within the following region: KEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSA
PNRC1 Rabbit Polyclonal Antibody
TA361662

USD 360.00

5 Days

PNRC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human PNRC1