Germany
Japan
United Kingdom
China
KTEL1 (POGLUT1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 360~390 amino acids from the C-terminal region of human KTEL1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-POGLUT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POGLUT1 antibody is: synthetic peptide directed towards the N-terminal region of Human POGLUT1. Synthetic peptide located within the following region: FLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDL |
POGLUT1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-280 of human POGLUT1 (NP_689518.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- POGLUT1