Germany
Japan
United Kingdom
China
Periplakin (PPL) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, IP, WB |
| Reactivities | Bovine, Human |
| Immunogen | Synthetic peptides of human periplakin (P1a/b, P2a/b, P3a/b), coupled to KLH |
Antibodies
View as table DownloadRabbit Polyclonal Anti-PPL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPL antibody: synthetic peptide directed towards the middle region of human PPL. Synthetic peptide located within the following region: EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF |
PPL Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PPL (NP_002696.3). |
| Modifications | Unmodified |
PPL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PPL (NP_002696.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PPL