Rabbit Polyclonal Anti-Ppp2r2d Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp2r2d Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RRDVTLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLDFNKKILHTA |
Rabbit Polyclonal Anti-Ppp2r2a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp2r2a Antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a. Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI |
Germany
Japan
United Kingdom
China