Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-PRDX4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRDX4 |
Anti-PRDX4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 38-271 amino acids of human peroxiredoxin 4 |
Rabbit Polyclonal Anti-PRDX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDX4. Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL |
Rabbit Polyclonal Anti-PRDX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the C-terminal region of Human PRDX4. Synthetic peptide located within the following region: GLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWK |
PRDX4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRDX4 |
Peroxiredoxin 4 (PRDX4) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)). |
USD 523.00
2 Weeks
USD 523.00
2 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PRDX4