Peroxiredoxin-5 / PRDX5 mouse monoclonal antibody, clone AT6A10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Peroxiredoxin-5 / PRDX5 mouse monoclonal antibody, clone AT6A10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Peroxiredoxin-5 / PRDX5 mouse monoclonal antibody, clone AT6A10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Peroxiredoxin 5 (PRDX5) mouse monoclonal antibody, clone 12A, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-PRDX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX5 antibody: synthetic peptide directed towards the middle region of human PRDX5. Synthetic peptide located within the following region: TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI |
Carrier-free (BSA/glycerol-free) PRDX5 mouse monoclonal antibody,clone OTI3B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX5 mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX5 mouse monoclonal antibody,clone OTI4B12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX5 mouse monoclonal antibody,clone OTI4C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRDX5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 56-214 amino acids of human peroxiredoxin 5 |
Anti-PRDX5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 56-214 amino acids of human peroxiredoxin 5 |
Peroxiredoxin 5 (PRDX5) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (Peroxiredoxin 5 (PRDX5)) (NP_036226.1). |
Modifications | Unmodified |
Peroxiredoxin 5 (PRDX5) Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (Peroxiredoxin 5 (PRDX5)) (NP_036226.1). |
Modifications | Unmodified |
Peroxiredoxin 5 Rabbit monoclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX5 mouse monoclonal antibody,clone OTI3B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI3B6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI3B6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRDX5 mouse monoclonal antibody,clone OTI3B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX5 mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI3A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI3A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRDX5 mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX5 mouse monoclonal antibody,clone OTI4B12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI4B12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI4B12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRDX5 mouse monoclonal antibody,clone OTI4B12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX5 mouse monoclonal antibody,clone OTI4C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI4C5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PRDX5 mouse monoclonal antibody,clone OTI4C5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRDX5 mouse monoclonal antibody,clone OTI4C5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |