Rabbit Polyclonal Anti-PREP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PREP antibody: synthetic peptide directed towards the N terminal of human PREP. Synthetic peptide located within the following region: THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF |
Prolyl Endopeptidase (PREP) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence (NP_002717.3). |
Rabbit Polyclonal Anti-PREP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PREP antibody: synthetic peptide directed towards the middle region of human PREP. Synthetic peptide located within the following region: LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM |
PREP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human PREP (NP_002717.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
