Rabbit Polyclonal Anti-Prepl Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Prepl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prepl. Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP |
PREPL rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PREPL |
PREPL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 578-727 of human PREPL (NP_006027.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
