Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
PRKCB rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCB |
Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit polyclonal anti-PKC beta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the C-terminus of mouse PKC β1 |
PKC beta 1 (PRKCB) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal PRKCB1(Thr641) antibody(Phospho-spcific)
| Applications | WB |
| Reactivities | Mouse:Thr641 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PRKCBaround the phosphorylation site of threonine 641. |
| Modifications | Phospho-specific |
Rabbit polyclonal Anti-PRKCB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC |
Rabbit polyclonal Anti-PRKCB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS |
Rabbit anti PKC Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-term of human PKC beta. This sequence is identical to mouse and rat. |
Goat Anti-PRKCB, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEFTRQPVELT., from the internal region (near C terminus) of the protein sequence according to NP_997700.1. |
Rabbit Polyclonal Anti-PRKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCB |
PRKCB Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PRKCB |
PRKCB Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PRKCB1 |
PRKCB Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PRKCB (NP_002729.2). |
| Modifications | Unmodified |
Phospho-PRKCB-T641 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around of human Phospho-PRKCB-T641. |
| Modifications | Phospho T641 |
PKC beta 2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PKC beta 2 |
PKC beta 2 Rabbit monoclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PRKCB
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
Pathways
- B cell receptor signaling pathway (12)
- Calcium signaling pathway (12)
- Chemokine signaling pathway (12)
- ErbB signaling pathway (12)
- Fc epsilon RI signaling pathway (12)
- Fc gamma R-mediated phagocytosis (12)
- Focal adhesion (12)
- Gap junction (12)
- Glioma (12)
- GnRH signaling pathway (12)
- Leukocyte transendothelial migration (12)
- Long-term depression (12)
- Long-term potentiation (12)
- MAPK signaling pathway (12)
- Melanogenesis (12)
- Natural killer cell mediated cytotoxicity (12)
- Non-small cell lung cancer (12)
- Pathways in cancer (12)
- Phosphatidylinositol signaling system (12)
- Tight junction (12)
- VEGF signaling pathway (12)
- Vascular smooth muscle contraction (12)
- Vibrio cholerae infection (12)
- Wnt signaling pathway (12)