Antibodies

Jump to Filters
View as table Download
PRMT1 Rabbit Polyclonal Antibody
TA345680

USD 410.00

5 Days

Rabbit Polyclonal Anti-PRMT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT1 antibody: synthetic peptide directed towards the middle region of human PRMT1. Synthetic peptide located within the following region: ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY
PRMT1 (C-term) Rabbit Polyclonal Antibody
AP22791PU-N

USD 440.00

2 Weeks

PRMT1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen PRMT1 antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of human PRMT1.
PRMT1 (C-term) Rabbit Polyclonal Antibody
AP22792PU-N

USD 440.00

2 Weeks

PRMT1 (C-term) rabbit polyclonal antibody, Ig Fraction

Applications IHC, WB
Reactivities Human, Mouse
Immunogen PRMT1 antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of human PRMT1.
PRMT1 Mouse Monoclonal Antibody [Clone ID: 4E9-H9-H12]
TA347030

USD 380.00

4 Weeks

Mouse Monoclonal PRMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
PRMT1 Rabbit Polyclonal Antibody
TA380386

USD 220.00

3 Weeks

PRMT1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-353 of human PRMT1 (NP_938074.2).
Modifications Unmodified
PRMT1 Rabbit Monoclonal Antibody [Clone ID: R08-3H8]
TA385057

USD 380.00

4 Weeks

PRMT1 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated