Rabbit Polyclonal Anti-PRR13 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRR13 antibody: synthetic peptide directed towards the middle region of human PRR13. Synthetic peptide located within the following region: PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP |
Rabbit Polyclonal Anti-PRR13 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRR13 antibody: synthetic peptide directed towards the N terminal of human PRR13. Synthetic peptide located within the following region: MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG |
Germany
Japan
United Kingdom
China