Antibodies

Jump to Filters
View as table Download
PSMB5 Rabbit Polyclonal Antibody
TA332481

USD 275.00

3 Weeks

Rabbit anti-PSMB5 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMB5
PSMB5 Goat Polyclonal Antibody
AP22975PU-N

USD 440.00

2 Weeks

PSMB5 goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish
Immunogen PSMB5 antibody was raised against synthetic peptide from human PSMB5 / MB1
PSMB5 Rabbit Polyclonal Antibody
TA342169

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB5 antibody: synthetic peptide directed towards the middle region of human PSMB5. Synthetic peptide located within the following region: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ