Antibodies

Jump to Filters
View as table Download
Proteasome 20S beta 6 (PSMB6) Rabbit Polyclonal Antibody
TA342170

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB6 antibody: synthetic peptide directed towards the N terminal of human PSMB6. Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA
Proteasome 20S beta 6 (PSMB6) Rabbit Polyclonal Antibody
TA380454

USD 220.00

3 Weeks

PSMB6 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-239 of human PSMB6 (NP_002789.1).
Modifications Unmodified