Antibodies

Jump to Filters
View as table Download
PTDSS1 Rabbit Polyclonal Antibody
TA341954

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-PTDSS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTDSS1 antibody: synthetic peptide directed towards the N terminal of human PTDSS1. Synthetic peptide located within the following region: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI
PTDSS1 Rabbit Polyclonal Antibody
TA380487

USD 220.00

3 Weeks

PTDSS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PTDSS1 (NP_055569.1).
Modifications Unmodified