Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ |
FAP-1 / PTPN13 Rabbit Polyclonal (aa2451-2466) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FAP-1 / PTPN13 antibody was raised against synthetic peptide from human PTPN13. |
Rabbit Polyclonal Anti-PTPN13 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PTPN13 |
PTPN13 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-500 of human PTPN13 (NP_542416.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PTPN13