Antibodies

Jump to Filters
View as table Download
PTPN7 Rabbit Polyclonal Antibody
TA343182

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN7 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ptpn7 antibody is: synthetic peptide directed towards the middle region of Rat Ptpn7. Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3G2]
CF503626

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTPN7 mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
CF503662

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTPN7 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3B10]
CF503714

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTPN7 mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
PTPN7 Rabbit Polyclonal Antibody
TA350309

USD 345.00

In Stock

Rabbit Polyclonal Anti-PTPN7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN7
PTPN7 Rabbit Polyclonal Antibody
TA360199

USD 360.00

5 Days

PTPN7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PTPN7
PTPN7 Rabbit Polyclonal Antibody
TA361556

USD 360.00

5 Days

PTPN7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PTPN7
PTPN7 Rabbit Polyclonal Antibody
TA362162

USD 360.00

5 Days

PTPN7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PTPN7
PTPN7 Rabbit Polyclonal Antibody
TA369291

USD 380.00

4 Weeks

PTPN7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN7
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3G2]
TA503626

USD 379.00

In Stock

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G2]
TA503626BM

USD 420.00

4 Weeks

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3G2 (formerly 3G2), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3G2]
TA503626S

USD 159.00

2 Days

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
TA503662

USD 379.00

In Stock

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
TA503662S

USD 159.00

2 Days

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3B10]
TA503714

USD 379.00

In Stock

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
PTPN7 Mouse Monoclonal Antibody [Clone ID: OTI3B10]
TA503714S

USD 159.00

2 Days

PTPN7 (HePTP) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated