Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-PTX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTX3 antibody: synthetic peptide directed towards the N terminal of human PTX3. Synthetic peptide located within the following region: RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL |
Rabbit polyclonal Anti-PTX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTX3 antibody: synthetic peptide directed towards the N terminal of human PTX3. Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG |
Pentraxin 3 (PTX3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 119-148 amino acids from the Central region of Human PTX3. |
Rabbit Polyclonal Anti-PTX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PTX3 |
PTX3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-240 of human PTX3 (NP_002843.2). |
| Modifications | Unmodified |
PTX3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-240 of human PTX3 (NP_002843.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PTX3