Rabbit Polyclonal Anti-PURA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PURA Antibody: synthetic peptide directed towards the middle region of human PURA. Synthetic peptide located within the following region: VEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYM |
Rabbit Polyclonal Anti-PURA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PURA Antibody: synthetic peptide directed towards the N terminal of human PURA. Synthetic peptide located within the following region: MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGGA |
Rabbit Polyclonal Anti-PURA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PURA antibody: synthetic peptide directed towards the N terminal of human PURA. Synthetic peptide located within the following region: GGGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGR |
Pura Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
PURA Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PURA |
PURA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 203-322 of human PURA (NP_005850.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
