Rabbit Polyclonal Anti-PUS7L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK |
Rabbit Polyclonal Anti-PUS7L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: FKISEIQLEPNNFPKKPKLDLQNLSLEDGRNQEVHTLIKYTDGDQNHQSG |
PUS7L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PUS7L (NP_112582.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China