Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR103 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR103 Antibody: A synthesized peptide derived from human GPR103 |
Rabbit polyclonal anti-GPR103 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GPR103. |
Rabbit Polyclonal Anti-QRFPR Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | QRFPR / GPR103 antibody was raised against synthetic 20 amino acid peptide from N-Terminus of human QRFPR / GPR103. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Bovine, Horse, Rabbit, Pig (100%); Monkey, Rat, Dog, Elephant (95%); Mouse, Panda (90%); Bat, Turkey, Zebra finch, Chicken, Platypus, Xenopus (85%); Opossum (80%). |
Rabbit Polyclonal Anti-QRFPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QRFPR antibody: synthetic peptide directed towards the C terminal of human QRFPR. Synthetic peptide located within the following region: FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENS |
Active filters
Target Symbol
- QRFPR