Rabbit polyclonal QTRTD1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This QTRTD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 321-350 amino acids from the C-terminal region of human QTRTD1. |
Rabbit Polyclonal Anti-QTRTD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QTRTD1 antibody: synthetic peptide directed towards the N terminal of human QTRTD1. Synthetic peptide located within the following region: YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI |
Rabbit Polyclonal Anti-Qtrtd1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Qtrtd1 antibody is: synthetic peptide directed towards the C-terminal region of Qtrtd1. Synthetic peptide located within the following region: EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE |
QTRT2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human QTRTD1 |
Germany
Japan
United Kingdom
China
